PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa13g003870.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 211aa    MW: 24350.3 Da    PI: 7.6612
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa13g003870.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox53.83.3e-1775127456
                     -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       ++t+eq+  Le  F+++ +++ e++ +L+++lgL+ rq  vWFqNrRa++k
  Csa13g003870.1  75 NKRLTSEQIASLEVSFQEDIKLDSERKLKLSRELGLQPRQTAVWFQNRRARWK 127
                     5679************************************************9 PP

2HD-ZIP_I/II112.62.5e-3673161189
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                     +k +rl++eq+++LE sF+e+ kL++erK +l+reLglqprq avWFqnrRAR+k k+lE+ y++L+++yda+ +en++L +ev++Lr+
  Csa13g003870.1  73 KKNKRLTSEQIASLEVSFQEDIKLDSERKLKLSRELGLQPRQTAVWFQNRRARWKVKHLEESYDSLRQEYDAVWKENQMLYDEVKKLRA 161
                     589************************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.92E-1757128IPR009057Homeodomain-like
PROSITE profilePS5007116.13169129IPR001356Homeobox domain
SMARTSM003891.1E-1572133IPR001356Homeobox domain
CDDcd000861.12E-1373130No hitNo description
PfamPF000461.0E-1474127IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.1E-1775137IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MEWSTTSNVQ NERDPFMPPP RLESNWLHSF NYDLFAGNSY THAAVTQTGP VPESEKMINT  60
YHCDSSNNNE MIKKNKRLTS EQIASLEVSF QEDIKLDSER KLKLSRELGL QPRQTAVWFQ  120
NRRARWKVKH LEESYDSLRQ EYDAVWKENQ MLYDEVKKLR AIILRDQGLM MNINQIAGGG  180
QTNGIGGYNN SPMIVASSRW TPISQPPNPW *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM2142331e-127KM214233.1 Capsella grandiflora isolate C.g926a RCO-A (RCO-A) gene, complete cds.
GenBankKM2142341e-127KM214234.1 Capsella grandiflora isolate C.g926b RCO-A (RCO-A) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010456386.11e-158PREDICTED: putative homeobox-leucine zipper protein ATHB-51
SwissprotQ9LZR01e-82ATB51_ARATH; Putative homeobox-leucine zipper protein ATHB-51
TrEMBLA0A077B3F21e-117A0A077B3F2_9BRAS; RCO-A
STRINGAl_scaffold_0006_2901e-113(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16602888
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G03790.18e-79homeobox 51